Spanish
 
 

Dyslexia Checklist

If the answer to most of the following questions is 'Yes' it would be wise to seek advice:

All ages

  • Is s/he bright in some ways with a 'block' in others?
  • Is there anyone else in the family with similar difficulties?
  • Does s/he have difficulty carrying out three instructions in sequence?
  • Was s/he late in learning to talk, or with speaking clearly?

Ages 7-11

  • Does s/he have particular difficulty with reading or spelling?
  • Does s/he put figures or letters the wrong way e.g. 15 for 51, 6 for 9, b for d, was for saw?
  • Does s/he read a word then fail to recognise it further down the page?
  • Does s/he spell a word several different ways without recognising the correct version?
  • Does s/he have a poor concentration span for reading and writing?
  • Does s/he have difficulty understanding time and tense?
  • Does s/he confuse left and right?
  • Does s/he answer questions orally but have difficulty writing the answer?
  • Is s/he unusually clumsy?
  • Does s/he have trouble with sounds in words, e.g. poor sense of rhyme?
From the Dyslexia Institute

 

 

Copyright © 1995-2008 Sara Jordan Publishing, a division of Jordan Music Productions Inc. All rights reserved.
homespecialsactivitiesreviewslinkscontact us
privacy policy